Rat VEGF C Recombinant Protein (RPPB1085)
제품 코드를 사용하여 Assay Genie 메인 사이트를 통해 주문합니다.
주문- SKU:
- RPPB1085
- Product type:
- Recombinant Protein
- Size:
- 10ug
- Species:
- Rat
- Target:
- VEGF C
- Synonyms:
- VEGF-C
- Synonyms:
- Vascular endothelial growth factor C
- Synonyms:
- VRP
- Synonyms:
- Flt4 ligand
- Source:
- Sf9 Insect cells
- Uniprot:
- P16612
Description
Product Name: | Rat VEGF C Recombinant Protein |
Product Code: | RPPB1085 |
Size: | 10µg |
Species: | Rat |
Target: | VEGF C |
Synonyms: | VEGF-C, Vascular endothelial growth factor C, VRP, Flt4 ligand, Flt4-L. |
Source: | Sf9 Insect cells |
Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
Formulation: | Each mg of VEGF-C Rat contains 50mg BSA and PBS as buffer. |
Solubility: | It is recommended to reconstitute the lyophilized Vascular Endothelial Growth Factor C in sterile 18M?-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Stability: | Lyophilized Vascular Endothelial Growth Factor-C although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGF-C should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles. |
Purity: | Greater than 90.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Amino Acid Sequence: | DTVKLAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKP PCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFA NHTSCRCMSKLDVYRQVHSIIHHHHHH |
Biological Activity: | Measured by its ability to stimulate phosphorylation of the VEGFR-3/FLT-4 receptor in porcine aortic endothelial cells. The ED50 for this effect is typically 200-300ng/ml corresponding to a Specific Activity of 3,334-5,000IU/mg. |
VEGF-C, also known as Vascular Endothelial Growth Factor Related Protein (VRP), is a recently discovered VEGF growth factor family member that is most closely related to VEGF-D. The rat VEGFC cDNA encodes a pre-pro-protein of 416 amino acids residues. It is almost identical to the mouse VEGF-C protein. Similar to VEGF-D, VEGF-C has a VEGF homology domain spanning the middle third of the precursor molecule and long N- and C-terminal extensions. In adults, VEGF-C is highly expressed in heart, placenta, ovary and small intestine. Recombinant rat VEGF-C, lacking the N- and C-terminal extensions and containing only the middle VEGF homology domain, forms primarily non-covalently linked dimers. This protein is a ligand for both VEGFR-2/KDR and VEGFR-3/FLT -4. Since VEGFR-3 is strongly expressed in lymphatic endothelial cells, it has been postulated that VEGF-C is involved in the regulation of the growth and/or differentiation of lymphatic endothelium. Although recombinant rat VEGF-C is also a mitogen for vascular endothelial cells, it is much less potent than VEGF-A.
Vascular Endothelial Growth Factor C Rat Recombinant contains 129 amino acids residues and was fused to a His- tag (6x His) at the C-terminal end. As a result of glycosylation VEGF-C migrates as an 18-24 kDa protein in SDS-PAGE under reducing conditions.
UniProt Protein Function: | VEGF: Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. Defects in VEGFA are a cause of susceptibility to microvascular complications of diabetes type 1 (MVCD1). These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. Belongs to the PDGF/VEGF growth factor family. 13 isoforms of the human protein are produced by alternative promoter. |
UniProt Protein Details: | Protein type:Cytokine; Secreted, signal peptide; Motility/polarity/chemotaxis; Secreted Cellular Component: basement membrane; cell surface; cytoplasm; extracellular region; extracellular space; membrane; nucleus; secretory granule Molecular Function:chemoattractant activity; cytokine activity; extracellular matrix binding; fibronectin binding; growth factor activity; growth factor binding; heparin binding; identical protein binding; platelet-derived growth factor receptor binding; protein heterodimerization activity; protein homodimerization activity; receptor agonist activity; receptor binding; vascular endothelial growth factor receptor 1 binding; vascular endothelial growth factor receptor 2 binding; vascular endothelial growth factor receptor binding Biological Process: activation of CREB transcription factor; activation of protein kinase activity; aging; alveolus development; angiogenesis; artery morphogenesis; basophil chemotaxis; blood vessel development; blood vessel endothelial cell proliferation during sprouting angiogenesis; blood vessel morphogenesis; blood vessel remodeling; branching morphogenesis of a tube; camera-type eye morphogenesis; cardiac muscle fiber development; cell differentiation; cell maturation; cell migration; cell migration during sprouting angiogenesis; cell proliferation; endothelial cell migration; epithelial cell differentiation; eye photoreceptor cell development; female pregnancy; growth; heart morphogenesis; homeostasis of number of cells within a tissue; hyaluronan metabolic process; in utero embryonic development; induction of positive chemotaxis; kidney development; lactation; lumen formation; lung development; lymphangiogenesis; macrophage differentiation; mesoderm development; monocyte differentiation; mRNA stabilization; negative regulation of apoptosis; negative regulation of bone resorption; negative regulation of caspase activity; negative regulation of cell-cell adhesion; negative regulation of fat cell differentiation; negative regulation of neuron apoptosis; negative regulation of programmed cell death; negative regulation of transcription from RNA polymerase II promoter; nervous system development; neuron development; ovarian follicle development; patterning of blood vessels; positive chemotaxis; positive regulation of angiogenesis; positive regulation of axon extension involved in axon guidance; positive regulation of blood vessel endothelial cell migration; positive regulation of cell adhesion; positive regulation of cell division; positive regulation of cell migration; positive regulation of cell motility; positive regulation of cell proliferation; positive regulation of endothelial cell proliferation; positive regulation of epithelial cell proliferation; positive regulation of focal adhesion formation; positive regulation of MAP kinase activity; positive regulation of mesenchymal cell proliferation; positive regulation of neuroblast proliferation; positive regulation of osteoblast differentiation; positive regulation of peptidyl-serine phosphorylation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of positive chemotaxis; positive regulation of protein amino acid autophosphorylation; positive regulation of protein amino acid phosphorylation; positive regulation of protein complex assembly; positive regulation of protein kinase B signaling cascade; positive regulation of receptor internalization; positive regulation of signal transduction; positive regulation of smooth muscle cell proliferation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of vascular endothelial growth factor receptor signaling pathway; positive regulation of vascular permeability; post-embryonic camera-type eye development; regulation of cell shape; regulation of cGMP metabolic process; regulation of endothelial cell differentiation; regulation of transcription from RNA polymerase II promoter; response to cold; response to estradiol stimulus; response to folic acid; response to hypoxia; response to progesterone stimulus; response to vitamin A; sprouting angiogenesis; surfactant homeostasis; T-helper 1 type immune response; vascular endothelial growth factor receptor signaling pathway; vasculature development; wound healing |
NCBI Summary: | This gene is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This gene is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. There is also evidence for alternative translation initiation from upstream non-AUG (CUG) codons resulting in additional isoforms. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is antiangiogenic. Expression of some isoforms derived from the AUG start codon is regulated by a small upstream open reading frame, which is located within an internal ribosome entry site. [provided by RefSeq, Nov 2015] |
UniProt Code: | P16612 |
NCBI GenInfo Identifier: | 17380502 |
NCBI Gene ID: | 83785 |
NCBI Accession: | P16612.2 |
UniProt Secondary Accession: | P16612,Q541S6, Q91ZE1, Q9JKX7, Q9QXG6, Q9QXG7, |
UniProt Related Accession: | P16612 |
Molecular Weight: | 17,189 Da |
NCBI Full Name: | Vascular endothelial growth factor A |
NCBI Synonym Full Names: | vascular endothelial growth factor A |
NCBI Official Symbol: | Vegfa |
NCBI Official Synonym Symbols: | VPF; Vegf; VEGF-A; VEGF164 |
NCBI Protein Information: | vascular endothelial growth factor A |
UniProt Protein Name: | Vascular endothelial growth factor A |
UniProt Synonym Protein Names: | Vascular permeability factor; VPF |
Protein Family: | VEGF coregulated chemokine |
UniProt Gene Name: | Vegfa |
UniProt Entry Name: | VEGFA_RAT |