Rat CNTF Recombinant Protein (RPPB0131)
- SKU:
- RPPB0131
- Product type:
- Recombinant Protein
- Size:
- 25ug
- Species:
- Rat
- Target:
- CNTF
- Synonyms:
- HCNTF
- CNTF
- Ciliary Neurotrophic Factor
- Source:
- Escherichia Coli
- Uniprot:
- P20294
Description
| Product Name: | Rat CNTF Recombinant Protein |
| Product Code: | RPPB0131 |
| Size: | 25µg |
| Species: | Rat |
| Target: | CNTF |
| Synonyms: | HCNTF, CNTF, Ciliary Neurotrophic Factor. |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation: | Lyophilized from a concentrated (1mg/ml) solution in water containing 0.025% NaHCO3. |
| Solubility: | It is recommended to reconstitute the lyophilized CNTF in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein. |
| Stability: | Lyophilized CNTF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CNTF should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles. |
| Purity: | Greater than 99.0% as determined by:(a) Analysis by Gel Filtration.(b) Analysis by SDS-PAGE. |
| Amino Acid Sequence: | AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM |
| Biological Activity: | Fully biologically active by its ability to phosphorylate STAT3 in several cells lines. |
CNTF is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. In addition to the predominant monocistronic transcript originating from this locus, the gene is also co-transcribed with the upstream ZFP91 gene. Co-transcription from the two loci results in a transcript that contains a complete coding region for the zinc finger protein but lacks a complete coding region for ciliary neurotrophic factor.CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy.
CNTF Recombinant Rat produced in E.Coli is a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 22834 Dalton. The CNTF is purified by proprietary chromatographic techniques.
| UniProt Protein Function: | CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy. |
| NCBI Summary: | a cytokine involved in neuronal degeneration and adipocyte gene expression [RGD, Feb 2006] |
| UniProt Code: | P20294 |
| NCBI GenInfo Identifier: | 116587 |
| NCBI Gene ID: | 25707 |
| NCBI Accession: | P20294.1 |
| UniProt Related Accession: | P20294 |
| Molecular Weight: | 22,854 Da |
| NCBI Full Name: | Ciliary neurotrophic factor |
| NCBI Synonym Full Names: | ciliary neurotrophic factor |
| NCBI Official Symbol: | Cntf |
| NCBI Protein Information: | ciliary neurotrophic factor; ciliary neurotropic factor |
| UniProt Protein Name: | Ciliary neurotrophic factor |
| Protein Family: | Ciliary neurotrophic factor |
| UniProt Gene Name: | Cntf |
| UniProt Entry Name: | CNTF_RAT |
Related Products
