Porcine Trypsin Recombinant Protein (RPPB5024)
제품 코드를 사용하여 Assay Genie 메인 사이트를 통해 주문합니다.
주문- SKU:
- RPPB5024
- Product type:
- Recombinant Protein
- Size:
- 2.5mg
- Species:
- Porcine
- Target:
- Trypsin
- Source:
- Escherichia Coli
Description
| Product Name: | Porcine Trypsin Recombinant Protein |
| Product Code: | RPPB5024 |
| Size: | 2.5mg |
| Species: | Porcine |
| Target: | Trypsin |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile Filtered lyophilized powder. |
| Formulation: | The Porcine Trypsin was lyophilized with mannitol as preservative. |
| Solubility: | It is recommended to reconstitute the lyophilized Porcine Trypsin in sterile 1mM HCl or 50mM HAC not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Stability: | Recombinant Porcine Trypsin although stable at room temp for 1 week, should be stored desiccated below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Amino Acid Sequence: | VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN |
| Biological Activity: | 4500 USP units/mg protein. |
Trypsin (EC3.4.21.4) is part of the serine protease family. Trypsin cleaves lysine and arginine at the C-terminal side of the peptide. The hydrolysis rate is slower if an acidic residue is on either sides of the cleavage site and no cleavage occurs if a proline residue is on the carboxyl side of the cleavage site. Trypsin optimum pH is pH-7 to 9. Trypsin will also hydrolyze ester and amide linkages of synthetic derivatives of amino acids such as: benzoyl L-arginine ethyl ester (BAEE), p-toluenesulfonyl- L-arginine methyl ester (TAME), tosyl-L-arginine methyl ester, N-?-benzoyl-L-arginine p-nitroanilide (BAPNA), L-lysyl-p-nitroanilide, and benzoyl-L-tyrosine ethyl ester (BTEE). Serine protease inhibitors that inhibit recombinant trypsin include TLCK (N-p-tosyl-L-lysine chloromethyl ketone), PMSF (phenylmethanesulfonyl fluoride), benzamidine, soybean trypsin inhibitor, and ovomucoid.
Recombinant Porcine Trypsin is expressed in E.coli and purified by standard chromatography techniques.
Related Products
Porcine Leptin Recombinant Protein (RPPB0713)
Porcine FSH Recombinant Protein (RPPB1309)
Porcine Procalcitonin Recombinant Protein (RPPB5751)
Porcine Thrombin Recombinant Protein (RPPB5146)
Porcine IL-4 Recombinant Protein (RPPB0513)
