Mouse LIF Recombinant Protein (RPPB0740)
- SKU:
- RPPB0740
- Product type:
- Recombinant Protein
- Size:
- 25ug
- Species:
- Mouse
- Target:
- LIF
- Synonyms:
- CDF
- HILDA
- D-FACTOR
- Differentiation- stimulating factor
- Source:
- Escherichia Coli
- Uniprot:
- P09056
Description
| Product Name: | Mouse LIF Recombinant Protein |
| Product Code: | RPPB0740 |
| Size: | 25µg |
| Species: | Mouse |
| Target: | LIF |
| Synonyms: | CDF, HILDA, D-FACTOR, Differentiation- stimulating factor, Melanoma-derived LPL inhibitor, MLPLI, Emfilermin, Leukemia inhibitory factor, LIF, DIA. |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation: | Leukemia Inhibitory Factor (LIF) was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM Phosphate buffer pH-7.4 and 0.02% Tween-20. |
| Solubility: | It is recommended to reconstitute the lyophilized Leukemia Inhibitory Factor (LIF) in sterile water not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Stability: | Lyophilized Leukemia Inhibitory Factor (LIF) although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Leukemia Inhibitory Factor (LIF) should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Purity: | Greater than 95.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Amino Acid Sequence: | MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF |
| Biological Activity: | Activity of murine LIF was determined by the M1 cell differentiation assay which was found to be < 0.01 ng/ml, corresponding to a specific activity of 100,000,000 IU/mg.A standard of 50 Units is defined as the concentration of mouse LIF in 1.0 mL of tissue culture medium that induces the differentiation of 50% of M1 colonies. |
Leukemia Inhibitory Factor also called LIF is a lymphoid factor that promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. Leukemia Inhibitory Factor has several functions such as cholinergic neuron differentiation, control of stem cell pluripotency, bone & fat metabolism, mitogenesis of factor dependent cell lines & promotion of megakaryocyte production in vivo. Human and mouse LIF exhibit a 78% identity in its amino acid sequence.
Leukemia Inhibitory Factor (LIF) Murine Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 181 amino acids and having a molecular mass of 20 kDa. The Leukemia Inhibitory Factor (LIF) is purified by proprietary chromatographic techniques.
| UniProt Protein Function: | LIF: LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes. Belongs to the LIF/OSM family. |
| UniProt Protein Details: | Protein type:Secreted; Secreted, signal peptide Cellular Component: extracellular space; cytoplasm; extracellular region Molecular Function:growth factor activity; leukemia inhibitory factor receptor binding; cytokine activity; receptor binding Biological Process: transcription from RNA polymerase II promoter; maternal process involved in pregnancy; leukemia inhibitory factor signaling pathway; negative regulation of hormone secretion; tyrosine phosphorylation of Stat3 protein; decidualization; positive regulation of tyrosine phosphorylation of Stat3 protein; positive regulation of adrenocorticotropic hormone secretion; negative regulation of cell proliferation; astrocyte differentiation; positive regulation of MAPKKK cascade; regulation of cell differentiation; positive regulation of cell proliferation; negative regulation of meiosis; positive regulation of macrophage differentiation; muscle morphogenesis; positive regulation of astrocyte differentiation; positive regulation of peptidyl-serine phosphorylation of STAT protein; organ regeneration; stem cell maintenance; stem cell differentiation; positive regulation of peptidyl-serine phosphorylation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of tyrosine phosphorylation of Stat1 protein; negative regulation of angiogenesis; retina development in camera-type eye; neuron development; immune response; positive regulation of transcription from RNA polymerase II promoter; blood vessel remodeling; alveolus development; embryo implantation; lung development |
| UniProt Code: | P09056 |
| NCBI GenInfo Identifier: | 126280 |
| NCBI Gene ID: | 16878 |
| NCBI Accession: | P09056.1 |
| UniProt Related Accession: | P09056 |
| Molecular Weight: | 22,287 Da |
| NCBI Full Name: | Leukemia inhibitory factor |
| NCBI Synonym Full Names: | leukemia inhibitory factor |
| NCBI Official Symbol: | Lif |
| NCBI Protein Information: | leukemia inhibitory factor; d factor; differentiation-stimulating factor |
| UniProt Protein Name: | Leukemia inhibitory factor |
| UniProt Synonym Protein Names: | Differentiation-stimulating factor; D factor |
| Protein Family: | Leukemia inhibitory factor |
| UniProt Gene Name: | Lif |
| UniProt Entry Name: | LIF_MOUSE |
Related Products
