Human TPO Recombinant Protein (RPPB1049)

(No reviews yet) Write a Review

제품 코드를 사용하여 Assay Genie 메인 사이트를 통해 주문합니다.

주문
SKU:
RPPB1049
Product type:
Recombinant Protein
Size:
10ug
Species:
Human
Target:
TPO
Synonyms:
Megakaryocyte colony-stimulating factor
Synonyms:
Myeloproliferative leukemia virus oncogene ligand
Synonyms:
C-mpl ligand
Synonyms:
ML
Source:
HEK293 Cells
Uniprot:
P40225
€0.00
Frequently bought together:

Description

Product Name:Human TPO Recombinant Protein
Product Code:RPPB1049
Size:10µg
Species:Human
Target:TPO
Synonyms:Megakaryocyte colony-stimulating factor, Myeloproliferative leukemia virus oncogene ligand, C-mpl ligand, ML, Megakaryocyte growth and development factor, MGDF, TPO, MKCSF, MPLLG, MGC163194, THPO.
Source:HEK293 Cells
Physical Appearance:Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation:The TPO protein was filtered (0.2µm) and lyophilized from 0.74mg/ml in 1xPBS.
Solubility:It is recommended to reconstitute the lyophilized Thrombopoietin in sterile PBS containing 0.1% endotoxin-free recombinant HSA.
Stability:Lyophilized Thrombopoietin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TPO should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Purity:Greater than 95% as obsereved by SDS-PAGE.
Amino Acid Sequence:SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLG EWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQV RLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGG STLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLK WQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAP DISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
Biological Activity:The activity was determined by the dose-dependent stimulation of the proliferation of MO7e cells, the ED50 is 1.15ng/ml.

Thrombopoietin is a glycoprotein hormone produced mainly by the liver and the kidney that regulates the production of platelets by the bone marrow. It stimulates the production and differentiation of megakaryocytes, the bone marrow cells that fragment into large numbers of platelets. 

Thrombopoietin Human Recombinant produced in HEK cells is a glycosylated monomer, having a molecular weight range of 80-85kDa due to glycosylation.The TPO is purified by proprietary chromatographic techniques.

UniProt Protein Function:THPO: Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets. Defects in THPO are the cause of thrombocythemia type 1 (THCYT1). A myeloproliferative disorder characterized by elevated platelet levels due to sustained proliferation of megakaryocytes, and frequently lead to thrombotic and haemorrhagic complications. Belongs to the EPO/TPO family. 3 isoforms of the human protein are produced by alternative splicing.
UniProt Protein Details:

Protein type:Cell cycle regulation; Secreted; Cytokine; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 3q27

Cellular Component: extracellular space

Molecular Function:growth factor activity; hormone activity; cytokine activity

Biological Process: positive regulation of protein kinase B signaling cascade; cell proliferation; platelet activation; multicellular organismal development; myeloid cell differentiation; positive regulation of megakaryocyte differentiation; positive regulation of protein amino acid phosphorylation; blood coagulation

Disease: Thrombocythemia 1

NCBI Summary:Megakaryocytopoiesis is the cellular development process that leads to platelet production. The main functional protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. Mutations in this gene are the cause of thrombocythemia 1. Alternative promoter usage and differential splicing result in multiple transcript variants differing in the 5' UTR and/or coding region. Multiple AUG codons upstream of the main open reading frame (ORF) have been identified, and these upstream AUGs inhibit translation of the main ORF at different extent. [provided by RefSeq, Feb 2014]
UniProt Code:P40225
NCBI GenInfo Identifier:730982
NCBI Gene ID:7066
NCBI Accession:P40225.1
UniProt Related Accession:P40225
Molecular Weight:
NCBI Full Name:Thrombopoietin
NCBI Synonym Full Names:thrombopoietin
NCBI Official Symbol:THPO  
NCBI Official Synonym Symbols:ML; TPO; MGDF; MKCSF; MPLLG; THCYT1  
NCBI Protein Information:thrombopoietin
UniProt Protein Name:Thrombopoietin
UniProt Synonym Protein Names:C-mpl ligand; ML; Megakaryocyte colony-stimulating factor; Megakaryocyte growth and development factor; MGDF; Myeloproliferative leukemia virus oncogene ligand
Protein Family:Thyroid peroxidase
UniProt Gene Name:THPO  
UniProt Entry Name:TPO_HUMAN
View AllClose

Related Products