Human TPO Recombinant Protein (RPPB1049)
- SKU:
- RPPB1049
- Product type:
- Recombinant Protein
- Size:
- 10ug
- Species:
- Human
- Target:
- TPO
- Synonyms:
- Megakaryocyte colony-stimulating factor
- Myeloproliferative leukemia virus oncogene ligand
- C-mpl ligand
- ML
- Source:
- HEK293 Cells
- Uniprot:
- P40225
Description
| Product Name: | Human TPO Recombinant Protein |
| Product Code: | RPPB1049 |
| Size: | 10µg |
| Species: | Human |
| Target: | TPO |
| Synonyms: | Megakaryocyte colony-stimulating factor, Myeloproliferative leukemia virus oncogene ligand, C-mpl ligand, ML, Megakaryocyte growth and development factor, MGDF, TPO, MKCSF, MPLLG, MGC163194, THPO. |
| Source: | HEK293 Cells |
| Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation: | The TPO protein was filtered (0.2µm) and lyophilized from 0.74mg/ml in 1xPBS. |
| Solubility: | It is recommended to reconstitute the lyophilized Thrombopoietin in sterile PBS containing 0.1% endotoxin-free recombinant HSA. |
| Stability: | Lyophilized Thrombopoietin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TPO should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Purity: | Greater than 95% as obsereved by SDS-PAGE. |
| Amino Acid Sequence: | SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLG EWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQV RLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGG STLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLK WQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAP DISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG |
| Biological Activity: | The activity was determined by the dose-dependent stimulation of the proliferation of MO7e cells, the ED50 is 1.15ng/ml. |
Thrombopoietin is a glycoprotein hormone produced mainly by the liver and the kidney that regulates the production of platelets by the bone marrow. It stimulates the production and differentiation of megakaryocytes, the bone marrow cells that fragment into large numbers of platelets.
Thrombopoietin Human Recombinant produced in HEK cells is a glycosylated monomer, having a molecular weight range of 80-85kDa due to glycosylation.The TPO is purified by proprietary chromatographic techniques.
| UniProt Protein Function: | THPO: Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets. Defects in THPO are the cause of thrombocythemia type 1 (THCYT1). A myeloproliferative disorder characterized by elevated platelet levels due to sustained proliferation of megakaryocytes, and frequently lead to thrombotic and haemorrhagic complications. Belongs to the EPO/TPO family. 3 isoforms of the human protein are produced by alternative splicing. |
| UniProt Protein Details: | Protein type:Cell cycle regulation; Secreted; Cytokine; Secreted, signal peptide Chromosomal Location of Human Ortholog: 3q27 Cellular Component: extracellular space Molecular Function:growth factor activity; hormone activity; cytokine activity Biological Process: positive regulation of protein kinase B signaling cascade; cell proliferation; platelet activation; multicellular organismal development; myeloid cell differentiation; positive regulation of megakaryocyte differentiation; positive regulation of protein amino acid phosphorylation; blood coagulation Disease: Thrombocythemia 1 |
| NCBI Summary: | Megakaryocytopoiesis is the cellular development process that leads to platelet production. The main functional protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. Mutations in this gene are the cause of thrombocythemia 1. Alternative promoter usage and differential splicing result in multiple transcript variants differing in the 5' UTR and/or coding region. Multiple AUG codons upstream of the main open reading frame (ORF) have been identified, and these upstream AUGs inhibit translation of the main ORF at different extent. [provided by RefSeq, Feb 2014] |
| UniProt Code: | P40225 |
| NCBI GenInfo Identifier: | 730982 |
| NCBI Gene ID: | 7066 |
| NCBI Accession: | P40225.1 |
| UniProt Related Accession: | P40225 |
| Molecular Weight: | |
| NCBI Full Name: | Thrombopoietin |
| NCBI Synonym Full Names: | thrombopoietin |
| NCBI Official Symbol: | THPO |
| NCBI Official Synonym Symbols: | ML; TPO; MGDF; MKCSF; MPLLG; THCYT1 |
| NCBI Protein Information: | thrombopoietin |
| UniProt Protein Name: | Thrombopoietin |
| UniProt Synonym Protein Names: | C-mpl ligand; ML; Megakaryocyte colony-stimulating factor; Megakaryocyte growth and development factor; MGDF; Myeloproliferative leukemia virus oncogene ligand |
| Protein Family: | Thyroid peroxidase |
| UniProt Gene Name: | THPO |
| UniProt Entry Name: | TPO_HUMAN |
Related Products
