Human TNFR2 Recombinant Protein (RPPB1012)
- SKU:
- RPPB1012
- Product type:
- Recombinant Protein
- Size:
- 20ug
- Species:
- Human
- Target:
- TNFR2
- Synonyms:
- Tumor necrosis factor receptor superfamily member 1B
- Tumor necrosis factor receptor 2
- Tumor necrosis factor receptor type II
- p75
- Source:
- Escherichia Coli
- Uniprot:
- P20333
Description
Product Name: | Human TNFR2 Recombinant Protein |
Product Code: | RPPB1012 |
Size: | 20µg |
Species: | Human |
Target: | TNFR2 |
Synonyms: | Tumor necrosis factor receptor superfamily member 1B, Tumor necrosis factor receptor 2, Tumor necrosis factor receptor type II, p75, p80 TNF-alpha receptor, CD120b, Etanercept, TNF-R2, TNF-RII, TNFR-II, TNFRSF1B, TNFBR, TNFR2, TBPII, TNFR2, TNFR1B, TNFR80, TNF-R75, p75TNFR, TNF-R-II. |
Source: | Escherichia Coli |
Physical Appearance: | Sterile Filtered clear solution. |
Formulation: | TNFR2 protein is supplied in 20mM Tris HCl pH-8, 5mM EDTA and 50% glycerol. |
Stability: | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles. |
Purity: | Greater than 95.0% as determined by SDS-PAGE. |
Amino Acid Sequence: | LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPT |
TNFR2 belongs to the TNF-receptor superfamily. TNFR2 is receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. TNFR2 mediates the majority of the metabolic effects of TNF-alpha. In addition, knockout studies in mice propose a role for TNFR2 in protecting neurons from apoptosis by stimulating antioxidative pathways. TNFR2 expression might have a significant role in the angiogenesis, tumor cell proliferation and metastasis of Invasive micropapillary carcinoma of the breast.There are 2 types of soluble TNF receptors: sTNFR-I and sTNFR-II, which act to neutralize the biological activities of TNF alpha and TNF beta. The levels of these soluble receptors seem to increase as a result of shedding of the extracellular domains of the membrane bound receptors. High levels of soluble TNF receptors are found in the amniotic fluid of pregnant women. TNFR2 and TNFR1 form a heterocomplex which mediates the recruitment of 2 anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. IAPs’ function in TNF-receptor signaling is unknown; nevertheless, c-IAP1 is believed to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Oxidative stress promotes TNFR1 and TNFR2 self-interaction, ligand-independent and enhanced ligand-dependent TNF signaling. TNF-a, TNFR1 and TNFR2 have roles in cellular differentiation. TNFR1 and TNFR2 function in cell type-specific renal injury.
TNFR2 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 184 amino acids fragment (23-206) having a molecular weight of 24.45kDa and fused with a 4.5kDa amino-terminal hexahistidine tag. The TNFR2 is purified by proprietary chromatographic techniques.
UniProt Protein Function: | TNF-R2: Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity. Binds to TRAF2. Interacts with BMX. 2 isoforms of the human protein are produced by alternative splicing. |
UniProt Protein Details: | Protein type:Membrane protein, integral; Receptor, cytokine Chromosomal Location of Human Ortholog: 1p36.22 Cellular Component: cell soma; perinuclear region of cytoplasm; integral to membrane; plasma membrane; extracellular region; nucleus; lipid raft Molecular Function:protein binding; tumor necrosis factor receptor activity; ubiquitin protein ligase binding Biological Process: tumor necrosis factor-mediated signaling pathway; DNA damage response, signal transduction resulting in induction of apoptosis; negative regulation of inflammatory response; immune response; RNA destabilization; inflammatory response; positive regulation of membrane protein ectodomain proteolysis; aging |
NCBI Summary: | The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. The function of IAPs in TNF-receptor signalling is unknown, however, c-IAP1 is thought to potentiate TNF-induced apoptosis by the ubiquitination and degradation of TNF-receptor-associated factor 2, which mediates anti-apoptotic signals. Knockout studies in mice also suggest a role of this protein in protecting neurons from apoptosis by stimulating antioxidative pathways. [provided by RefSeq, Jul 2008] |
UniProt Code: | P20333 |
NCBI GenInfo Identifier: | 21264534 |
NCBI Gene ID: | 7133 |
NCBI Accession: | P20333.3 |
UniProt Secondary Accession: | P20333,Q16042, Q6YI29, Q9UIH1, B1AJZ3, |
UniProt Related Accession: | P20333 |
Molecular Weight: | 28,461 Da |
NCBI Full Name: | Tumor necrosis factor receptor superfamily member 1B |
NCBI Synonym Full Names: | tumor necrosis factor receptor superfamily, member 1B |
NCBI Official Symbol: | TNFRSF1B |
NCBI Official Synonym Symbols: | p75; TBPII; TNFBR; TNFR2; CD120b; TNFR1B; TNFR80; TNF-R75; p75TNFR; TNF-R-II |
NCBI Protein Information: | tumor necrosis factor receptor superfamily member 1B; TNF-R2; TNF-RII; p75 TNF receptor; p80 TNF-alpha receptor; soluble TNFR1B variant 1; tumor necrosis factor receptor 2; tumor necrosis factor beta receptor; tumor necrosis factor receptor type II; tumor necrosis factor binding protein 2 |
UniProt Protein Name: | Tumor necrosis factor receptor superfamily member 1B |
UniProt Synonym Protein Names: | Tumor necrosis factor receptor 2; TNF-R2; Tumor necrosis factor receptor type II; TNF-RII; TNFR-II; p75; p80 TNF-alpha receptor; CD_antigen: CD120b; INN: EtanerceptCleaved into the following 2 chains:Tumor necrosis factor receptor superfamily member 1b, membrane form; Tumor necrosis factor-binding protein 2Alternative name(s):TBP-2; TBPII |
UniProt Gene Name: | TNFRSF1B |
UniProt Entry Name: | TNR1B_HUMAN |