Human IL 1 beta Recombinant Protein (RPPB0456)
- SKU:
- RPPB0456
- Product type:
- Recombinant Protein
- Size:
- 20ug
- Species:
- Human
- Target:
- IL 1 beta
- Synonyms:
- Catabolin
- Lymphocyte-activating factor (LAF)
- Endogenous Pyrogen (EP)
- Leukocyte Endogenous Mediator (LEM)
- Source:
- Escherichia Coli
- Uniprot:
- P01584
Description
| Product Name: | Human IL 1 beta Recombinant Protein |
| Product Code: | RPPB0456 |
| Size: | 20µg |
| Species: | Human |
| Target: | IL 1 beta |
| Synonyms: | Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta. |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile Filtered clear solution. |
| Formulation: | IL-1b His is supplied in 1x PBS and 50% glycerol. |
| Stability: | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles. |
| Purity: | Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Amino Acid Sequence: | APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
Interleukin-1b is a potent pro-inflammatory cytokine produced by a wide variety of cell types including monocytes and macrophages. It displays a broad range of biological activity including activation of B and T cells in response to inflammation and the activation of endothelial cells.
Interleukin-1 beta His-Tag Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 153 amino acids fragment (117-269) and having a total molecular mass of 21.88 kDa fused with an amino-terminal hexahistidine tag. The IL-1b His is purified by proprietary chromatographic techniques.
| UniProt Protein Function: | IL1B: Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. Monomer. Belongs to the IL-1 family. |
| UniProt Protein Details: | Protein type:Cytokine Chromosomal Location of Human Ortholog: 2q14 Cellular Component: extracellular space; extracellular region; cytosol; secretory granule Molecular Function:protein domain specific binding; interleukin-1 receptor binding; cytokine activity Biological Process: positive regulation of granulocyte macrophage colony-stimulating factor production; negative regulation of MAP kinase activity; positive regulation of nitric oxide biosynthetic process; activation of MAPK activity; positive regulation of transcription, DNA-dependent; positive regulation of interleukin-2 biosynthetic process; germ cell programmed cell death; negative regulation of insulin receptor signaling pathway; positive regulation of lipid catabolic process; positive regulation of NF-kappaB import into nucleus; fever; positive regulation of membrane protein ectodomain proteolysis; response to carbohydrate stimulus; activation of NF-kappaB transcription factor; cell-cell signaling; positive regulation of phagocytosis; positive regulation of T cell mediated immunity; positive regulation of T cell proliferation; neutrophil chemotaxis; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of heterotypic cell-cell adhesion; positive regulation of mitosis; smooth muscle adaptation; interleukin-1 beta production; positive regulation of interleukin-6 production; positive regulation of angiogenesis; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription factor activity; negative regulation of lipid metabolic process; sequestering of triacylglycerol; positive regulation of histone phosphorylation; apoptosis; positive regulation of interleukin-6 biosynthetic process; positive regulation of JNK cascade; signal transduction; positive regulation of vascular endothelial growth factor receptor signaling pathway; positive regulation of protein export from nucleus; positive regulation of interleukin-8 production; negative regulation of cell proliferation; negative regulation of lipid catabolic process; hyaluronan biosynthetic process; protein kinase B signaling cascade; lipopolysaccharide-mediated signaling pathway; inflammatory response; regulation of I-kappaB kinase/NF-kappaB cascade; cytokine and chemokine mediated signaling pathway; MAPKKK cascade; response to ATP; positive regulation of interferon-gamma production; positive regulation of chemokine biosynthetic process; positive regulation of prostaglandin secretion; positive regulation of fever; positive regulation of histone acetylation; immune response; positive regulation of protein amino acid phosphorylation; regulation of insulin secretion; embryo implantation Disease: Gastric Cancer, Hereditary Diffuse |
| NCBI Summary: | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq, Jul 2008] |
| UniProt Code: | P01584 |
| NCBI GenInfo Identifier: | 62906858 |
| NCBI Gene ID: | 3553 |
| NCBI Accession: | P01584.2 |
| UniProt Secondary Accession: | P01584,Q53X59, Q53XX2, Q7M4S7, Q7RU01, Q96HE5, Q9UCT6 |
| UniProt Related Accession: | P01584 |
| Molecular Weight: | 30,748 Da |
| NCBI Full Name: | Interleukin-1 beta |
| NCBI Synonym Full Names: | interleukin 1, beta |
| NCBI Official Symbol: | IL1B |
| NCBI Official Synonym Symbols: | IL-1; IL1F2; IL1-BETA |
| NCBI Protein Information: | interleukin-1 beta; IL-1 beta; catabolin; preinterleukin 1 beta; pro-interleukin-1-beta |
| UniProt Protein Name: | Interleukin-1 beta |
| UniProt Synonym Protein Names: | Catabolin |
| Protein Family: | Interleukin |
| UniProt Gene Name: | IL1B |
| UniProt Entry Name: | IL1B_HUMAN |
Related Products
