Human IL 1 alpha Recombinant Protein (RPPB0443)
제품 코드를 사용하여 Assay Genie 메인 사이트를 통해 주문합니다.
주문- SKU:
- RPPB0443
- Product type:
- Recombinant Protein
- Size:
- 10ug
- Species:
- Human
- Target:
- IL 1 alpha
- Synonyms:
- Hematopoietin-1
- Synonyms:
- Lymphocyte-activating factor (LAF)
- Synonyms:
- Endogenous Pyrogen (EP)
- Synonyms:
- Leukocyte Endogenous Mediator (LEM)
- Source:
- Escherichia Coli
- Uniprot:
- P01583
Description
Product Name: | Human IL 1 alpha Recombinant Protein |
Product Code: | RPPB0443 |
Size: | 10µg |
Species: | Human |
Target: | IL 1 alpha |
Synonyms: | Hematopoietin-1, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL-1 alpha,IL1, IL-1A, IL1F1. |
Source: | Escherichia Coli |
Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
Formulation: | The protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 25mM Tris-HCl, pH 8. |
Solubility: | It is recommended to reconstitute the lyophilized Interleukin 1 alpha in sterile 18M?-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Stability: | Lyophilized Interleukin-1 alpha although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1a should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles. |
Purity: | Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Amino Acid Sequence: | SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAV KFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITG SETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILE NQA |
Biological Activity: | The ED50 as determined by the dose-dependant stimulation of murine D10S cells is < 0.001 ng/ml, corresponding to a Specific Activity of 1 x 109 IU/mg. |
IL-1 alpha is produced by activated macrophages, stimulates thymocyte proliferation by inducing il-2 release, b-cell maturation and proliferation, and fibroblast growth factor activity. IL1A proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin from synovial cells.
Interleukin-1 alpha Human Recombinant produced in E.Coli is single, a non-glycosylated, Polypeptide chain containing 159 amino acids and having a molecular mass of 18022 Dalton. The IL-1A is purified by proprietary chromatographic techniques.
UniProt Protein Function: | IL1A: Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. Belongs to the IL-1 family. |
UniProt Protein Details: | Protein type:Motility/polarity/chemotaxis; Cytokine Chromosomal Location of Human Ortholog: 2q14 Cellular Component: extracellular space; extracellular region; cytosol Molecular Function:protein binding; copper ion binding; interleukin-1 receptor binding; cytokine activity Biological Process: positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of mitosis; apoptosis; positive regulation of interleukin-2 biosynthetic process; cytokine and chemokine mediated signaling pathway; germ cell programmed cell death; positive regulation of JNK cascade; fever; negative regulation of cell proliferation; cell proliferation; connective tissue replacement during inflammatory response; positive regulation of angiogenesis; response to copper ion; positive regulation of transcription from RNA polymerase II promoter; immune response; inflammatory response; positive regulation of cytokine secretion |
NCBI Summary: | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease. [provided by RefSeq, Jul 2008] |
UniProt Code: | P01583 |
NCBI GenInfo Identifier: | 124297 |
NCBI Gene ID: | 3552 |
NCBI Accession: | P01583.1 |
UniProt Secondary Accession: | P01583,Q53QF9, Q7RU02, |
UniProt Related Accession: | P01583 |
Molecular Weight: | 30,607 Da |
NCBI Full Name: | Interleukin-1 alpha |
NCBI Synonym Full Names: | interleukin 1, alpha |
NCBI Official Symbol: | IL1A |
NCBI Official Synonym Symbols: | IL1; IL-1A; IL1F1; IL1-ALPHA |
NCBI Protein Information: | interleukin-1 alpha; IL-1 alpha; hematopoietin-1; preinterleukin 1 alpha; pro-interleukin-1-alpha |
UniProt Protein Name: | Interleukin-1 alpha |
UniProt Synonym Protein Names: | Hematopoietin-1 |
Protein Family: | Interleukin |
UniProt Gene Name: | IL1A |
UniProt Entry Name: | IL1A_HUMAN |