Human GMFB Recombinant Protein (RPPB0362)
- SKU:
- RPPB0362
- Product type:
- Recombinant Protein
- Size:
- 10ug
- Species:
- Human
- Target:
- GMFB
- Synonyms:
- Glia maturation factor beta
- GMFB
- GMF-B
- GMF-beta
- Source:
- Escherichia Coli
- Uniprot:
- P60983
Description
| Product Name: | Human GMFB Recombinant Protein |
| Product Code: | RPPB0362 |
| Size: | 10µg |
| Species: | Human |
| Target: | GMFB |
| Synonyms: | Glia maturation factor beta, GMFB, GMF-B, GMF-beta, GMF. |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation: | The GMF-beta protein was lyophilized after dialysis against 20mM PBS pH=7.4 and 130mM NaCl. |
| Solubility: | It is recommended to reconstitute the lyophilized GMFB in sterile 18M?-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Stability: | Lyophilized GMF-B although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution GMF-beta should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Purity: | Greater than 98.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Amino Acid Sequence: | SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQT AELTKVFEIRNTEDLTEEWLREKLGFFH |
Glia Maturation Factor-Beta (GMF-Beta) is a 17 kDa protein nerve gorwth factor identified as a growth and differentiation factor in the vertebrate brain.Glia Maturation Factor-Beta stimulates differentiation of normal neurons as well as glial cells. GMFB inhibits the proliferation of the N-18 neuroblastoma line and the C6 glioma line while promoting their phenotypic expression.GMF-beta inhances the phenotypic expression of glia & neurons thus inhibits the proliferation of their respective tumors when added to cell culture. Although astrocytes produce GMF-b and stores it inside the cells, they don’t secrete the GMF-B into the cultured medium. Cell- surface GMFb acts on the target cells at close range when cells are in direct contact. GMF-Beta is produced by thymic epithelial cells and plays an important role in T cell development in favor of CD4+ T cells.GMF-Beta is a brain-specific protein which belongs to the actin-binding proteins (ADF) family. GMF-beta appears to play a role in the differentiation, maintenance, and regeneration of the nervous system. It also supports the progression of certain auto-immune diseases, possibly through its ability to induce the production and secretion of various pro-inflammatory cytokines.
Glia Maturation Factor-Beta (GMF-Beta) Human Recombinant produced in E.Coli is a signle, non-glycosylated, polypeptide chain containing 141 amino acids and having a total molecular mass of 16.5 kDa. Glia Maturation Factor-Beta, GMF-Beta, Human Recombinant is purified by proprietary chromatographic techniques.
| UniProt Protein Function: | GMF-beta: This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells. Belongs to the actin-binding proteins ADF family. GMF subfamily. |
| UniProt Protein Details: | Protein type:Inhibitor; Motility/polarity/chemotaxis; Actin-binding Chromosomal Location of Human Ortholog: 14q22.2 Molecular Function:enzyme activator activity; protein kinase inhibitor activity; signal transducer activity Biological Process: nervous system development; protein amino acid phosphorylation; signal transduction |
| UniProt Code: | P60983 |
| NCBI GenInfo Identifier: | 46577593 |
| NCBI Gene ID: | 2764 |
| NCBI Accession: | P60983.2 |
| UniProt Secondary Accession: | P60983,P17774, Q9BS35, B2R499, |
| UniProt Related Accession: | P60983 |
| Molecular Weight: | 16,713 Da |
| NCBI Full Name: | Glia maturation factor beta |
| NCBI Synonym Full Names: | glia maturation factor beta |
| NCBI Official Symbol: | GMFB |
| NCBI Official Synonym Symbols: | GMF |
| NCBI Protein Information: | glia maturation factor beta |
| UniProt Protein Name: | Glia maturation factor beta |
| Protein Family: | Glia maturation factor |
| UniProt Gene Name: | GMFB |
| UniProt Entry Name: | GMFB_HUMAN |
Related Products
