Human Fractalkine Recombinant Protein (RPPB1135)
제품 코드를 사용하여 Assay Genie 메인 사이트를 통해 주문합니다.
주문- SKU:
- RPPB1135
- Product type:
- Recombinant Protein
- Size:
- 20ug
- Species:
- Human
- Target:
- Fractalkine
- Synonyms:
- Fractalkine
- Synonyms:
- CX3CL1
- Synonyms:
- Neurotactin
- Synonyms:
- CX3C membrane-anchored chemokine
- Source:
- Escherichia Coli
- Uniprot:
- P78423
Description
Product Name: | Human Fractalkine Recombinant Protein |
Product Code: | RPPB1135 |
Size: | 20µg |
Species: | Human |
Target: | Fractalkine |
Synonyms: | Fractalkine, CX3CL1, Neurotactin, CX3C membrane-anchored chemokine, Small inducible cytokine D1, NTN, NTT, CXC3, CXC3C, SCYD1, ABCD-3, C3Xkine. |
Source: | Escherichia Coli |
Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
Formulation: | The CX3CL1 was lyophilized from a 0.2?m filtered concentrated (1.0 mg/ml) solution in 20mM Phosphate buffer, pH 7.4, 50mM NaCl. |
Solubility: | It is recommended to reconstitute the lyophilized CX3CL1 in sterile 18M?-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Stability: | Lyophilized CX3CL1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CX3CL1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
Purity: | Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Amino Acid Sequence: | QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQW VKDAMQHLDRQAAALTRNG |
Biological Activity: | The Biological activity is calculated by its ability to chemoattract human T-Lymphocytes using a concentration range of 5.0-10.0 ng/ml corresponding to a Specific Activity of 100,000-200,000IU/mg. |
Fractalkine soluble form is chemotactic for t-cells and monocytes, but not for neutrophils. Fractalkine membrane-bound form promotes adhesion of those leukocytes to endothelial cells. Fractalkine regulates leukocyte adhesion and migration processes at the endothelium and binds to CX3CR1. Natural Human Fractalkine is produced as a long protein (373-amino acid) with an extended mucin-like stalk and a chemokine domain on top. The mucin-like stalk permits it to bind to the cell surface. Fractalkine gene is located on human chromosome 16 along with some CC chemokines known as CCL17 and CCL22.
Fractalkine Human Recombinant- produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 76 amino acids and having a molecular mass of 8638 Dalton. The Fractalkine is purified by proprietary chromatographic techniques.
UniProt Protein Function: | CX3CL1: The soluble form is chemotactic for T-cells and monocytes, but not for neutrophils. The membrane-bound form promotes adhesion of those leukocytes to endothelial cells. May play a role in regulating leukocyte adhesion and migration processes at the endothelium. Binds to CX3CR1. Belongs to the intercrine delta family. |
UniProt Protein Details: | Protein type:Motility/polarity/chemotaxis; Membrane protein, integral Chromosomal Location of Human Ortholog: 16q13 Cellular Component: extracellular space; cell surface; integral to membrane; plasma membrane; extracellular region Molecular Function:protein binding; chemokine activity; receptor binding Biological Process: positive regulation of transforming growth factor-beta1 production; neutrophil chemotaxis; leukocyte chemotaxis; cytokine and chemokine mediated signaling pathway; defense response; chemotaxis; angiogenesis involved in wound healing; macrophage chemotaxis; leukocyte adhesive activation; positive regulation of angiogenesis; positive regulation of calcium-independent cell-cell adhesion; immune response; cell adhesion; lymphocyte chemotaxis; positive regulation of inflammatory response |
UniProt Code: | P78423 |
NCBI GenInfo Identifier: | 6175080 |
NCBI Gene ID: | 6376 |
NCBI Accession: | P78423.1 |
UniProt Secondary Accession: | P78423,O00672, |
UniProt Related Accession: | P78423 |
Molecular Weight: | 42,203 Da |
NCBI Full Name: | Fractalkine |
NCBI Synonym Full Names: | chemokine (C-X3-C motif) ligand 1 |
NCBI Official Symbol: | CX3CL1 |
NCBI Official Synonym Symbols: | NTN; NTT; CXC3; CXC3C; SCYD1; ABCD-3; C3Xkine; fractalkine; neurotactin |
NCBI Protein Information: | fractalkine; C-X3-C motif chemokine 1; small-inducible cytokine D1; CX3C membrane-anchored chemokine; small inducible cytokine subfamily D (Cys-X3-Cys), member-1; small inducible cytokine subfamily D (Cys-X3-Cys), member 1 (fractalkine, neurotactin) |
UniProt Protein Name: | Fractalkine |
UniProt Synonym Protein Names: | C-X3-C motif chemokine 1; CX3C membrane-anchored chemokine; Neurotactin; Small-inducible cytokine D1Cleaved into the following chain:Processed fractalkine |
Protein Family: | Fractalkine |
UniProt Gene Name: | CX3CL1 |
UniProt Entry Name: | X3CL1_HUMAN |