Human FGFR1 Recombinant Protein (RPPB5835)
제품 코드를 사용하여 Assay Genie 메인 사이트를 통해 주문합니다.
주문- SKU:
- RPPB5835
- Product type:
- Recombinant Protein
- Size:
- 10ug
- Species:
- Human
- Target:
- FGFR1
- Synonyms:
- FGFR-1
- Synonyms:
- bFGF-R
- Synonyms:
- C-FGR
- Synonyms:
- CD331
- Source:
- Insect Cells
- Uniprot:
- P11362
Description
| Product Name: | Human FGFR1 Recombinant Protein |
| Product Code: | RPPB5835 |
| Size: | 10µg |
| Species: | Human |
| Target: | FGFR1 |
| Synonyms: | FGFR-1, bFGF-R, C-FGR, CD331, fms-related tyrosine kinase 2, Pfeiffer syndrome, CEK, FLG, FLT2, KAL2, BFGFR, FGFBR, HBGFR, FGFR1/FGFR1OP2 FUSION GENE, FGFR1/ZNF198 FUSION GENE, FLG FGFR1/BCR FUSION GENE, FLG protein, FMS-LIKE GENE, N-sam tyrosine kinase, basic fibroblast growth factor receptor 1. |
| Source: | Insect Cells |
| Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation: | CD331 was lyophilized from a concentrated (1 mg/ml) sterile solution containing 1xPBS. |
| Solubility: | It is recommended to reconstitute the lyophilized bFGF-R in sterile PBS not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. |
| Stability: | Lyophilized FGFR1A although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FGFR1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Purity: | Greater than 90.0% as determined by SDS-PAGE. |
| Amino Acid Sequence: | RPSPTLPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQL AESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSS EDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFK CPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYT CIVENEYGSINHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYS DPQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSF EDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSPLYLEDPRRASIEG RGDPEEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV VVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ QGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Biological Activity: | Determined by its ability to inhibit human FGF acidic-dependent proliferation on R1 cells. The ED50 for this effect is typically at 15.0-30.0 ng/ml. |
Fibroblast Growth Factors (FGFs) comprise a family of at least eighteen structurally realted proteins that are involved in a multitude of physiological and pathological cellular processes, including cell growth, differentation, angiogenesis, wound healing and tumorgenesis. The biological activities of the FGFs are mediated by a family if type I transmembrane tyrosine kinases which undergo dimerization and autophosphorylation after ligand binding. Four distinct genes encoding closely related FGF receptors, FGFR-1to -4 are known. Multiple forms of FGFR-1 to -3 are generated by alternative splicing of the mRNAs. A frequent splicing event involving FGFR-1 and -2 results in receptors containing all three Ig domains Only the alpha isoform has been identified for FGFR-3 and FGFR-4. Additional splicing events for FGFR-1 to -3, involving the C-terminal half of the IgIII domain encoded by two mutually exclusive alternative exons, generate FGF receptors with alternative IgIII domains (IIIb and IIIc). A IIIa isoform which is a secreted FGF binding protein containing only the N-terminal half of the IgIII domain plus some intron sequences has also been reported for FGFR-1. Mutations in FGFR-1 to -3 have been found in patients with birth defects involving craniosynostosis.
Soluble FGFR-1a (IIIc) Fc Chimera Human Recombinant fused with Xa cleavage site with the Fc part of human IgG1 produced in baculovirus is a heterodimeric, glycosylated, Polypeptide chain containing 601 amino acids and having a molecular mass of 170 kDa. The FGFR1 is purified by proprietary chromatographic techniques.
| UniProt Protein Function: | FGFR1: a receptor tyrosine kinase of the highly-conserved fibroblast growth factor receptor (FGFR). Binds both acidic and basic fibroblast growth factors and is involved in limb induction. Point mutations cause Pfeffer syndrome (finger and toe malformations and other skeletal errors) and dominant Kallmann syndrome 2. Stem cell leukemia lymphoma syndrome (SCLL) may be caused by a t(8;13)(p12;q12) translocation that fuses a zinc finger gene, ZNF198, to FGFR1. Various myeloproliferative disorders have been linked to translocations that fuse FGFR1 to FOP, FIM, CEP1 or the atypical kinase, Bcr. Inhibitor: SU5402. 20 isoforms of the human protein produced by alternative splicing have been described. |
| UniProt Protein Details: | Protein type:Protein kinase, TK; Protein kinase, tyrosine (receptor); Oncoprotein; EC 2.7.10.1; Membrane protein, integral; Kinase, protein; TK group; FGFR family Chromosomal Location of Human Ortholog: 8p11.23-p11.22 Cellular Component: integral to plasma membrane; cytoplasmic membrane-bound vesicle; extracellular region; plasma membrane; integral to membrane; nucleus; cytosol; receptor complex Molecular Function:heparin binding; identical protein binding; protein binding; fibroblast growth factor binding; protein homodimerization activity; fibroblast growth factor receptor activity; protein-tyrosine kinase activity; ATP binding Biological Process: paraxial mesoderm development; axon guidance; peptidyl-tyrosine phosphorylation; nerve growth factor receptor signaling pathway; protein amino acid autophosphorylation; cell maturation; neuron migration; negative regulation of transcription from RNA polymerase II promoter; middle ear morphogenesis; protein amino acid phosphorylation; positive regulation of MAP kinase activity; sensory perception of sound; positive regulation of MAPKKK cascade; ureteric bud development; regulation of cell differentiation; induction of an organ; midbrain development; positive regulation of mesenchymal cell proliferation; positive regulation of cell proliferation; chondrocyte differentiation; angiogenesis; skeletal development; embryonic limb morphogenesis; positive regulation of cardiac muscle cell proliferation; epidermal growth factor receptor signaling pathway; inner ear morphogenesis; cell migration; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; chordate embryonic development; transcription, DNA-dependent; in utero embryonic development; outer ear morphogenesis; MAPKKK cascade; positive regulation of cell cycle; neuroblast division in the ventricular zone; positive regulation of phosphoinositide 3-kinase cascade; mesenchymal cell differentiation; skeletal morphogenesis; insulin receptor signaling pathway; auditory receptor cell development; innate immune response; positive regulation of neuron differentiation; regulation of lateral mesodermal cell fate specification Disease: Pfeiffer Syndrome; Hypogonadotropic Hypogonadism 2 With Or Without Anosmia; Jackson-weiss Syndrome; Trigonocephaly 1; Osteoglophonic Dysplasia |
| NCBI Summary: | The protein encoded by this gene is a member of the fibroblast growth factor receptor (FGFR) family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds both acidic and basic fibroblast growth factors and is involved in limb induction. Mutations in this gene have been associated with Pfeiffer syndrome, Jackson-Weiss syndrome, Antley-Bixler syndrome, osteoglophonic dysplasia, and autosomal dominant Kallmann syndrome 2. Chromosomal aberrations involving this gene are associated with stem cell myeloproliferative disorder and stem cell leukemia lymphoma syndrome. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq, Jul 2008] |
| UniProt Code: | P11362 |
| NCBI GenInfo Identifier: | 120046 |
| NCBI Gene ID: | 2260 |
| NCBI Accession: | P11362.3 |
| UniProt Secondary Accession: | P11362,P17049, Q02063, Q02065, Q14306, Q14307, Q53H63 Q59H40, Q5BJG2, A8K6T9, A8K8V5, C1KBH8, |
| UniProt Related Accession: | P11362 |
| Molecular Weight: | 91,868 Da |
| NCBI Full Name: | Fibroblast growth factor receptor 1 |
| NCBI Synonym Full Names: | fibroblast growth factor receptor 1 |
| NCBI Official Symbol: | FGFR1 |
| NCBI Official Synonym Symbols: | CEK; FLG; HH2; OGD; FLT2; KAL2; BFGFR; CD331; FGFBR; FLT-2; HBGFR; N-SAM; FGFR-1; HRTFDS; bFGF-R-1 |
| NCBI Protein Information: | fibroblast growth factor receptor 1; FGFR1/PLAG1 fusion; proto-oncogene c-Fgr; FMS-like tyrosine kinase 2; hydroxyaryl-protein kinase; fms-related tyrosine kinase 2; heparin-binding growth factor receptor; basic fibroblast growth factor receptor 1 |
| UniProt Protein Name: | Fibroblast growth factor receptor 1 |
| UniProt Synonym Protein Names: | Basic fibroblast growth factor receptor 1; BFGFR; bFGF-R-1; Fms-like tyrosine kinase 2; FLT-2; N-sam; Proto-oncogene c-Fgr |
| UniProt Gene Name: | FGFR1 |
| UniProt Entry Name: | FGFR1_HUMAN |
Related Products
Human FGFR1/CD331 Recombinant Protein (RPES2983)
Mouse FGFR1/CD331 Recombinant Protein (RPES3488)
Human UTP23 Recombinant Protein (RPPB5098)
Human VAMP4 Recombinant Protein (RPPB5106)
Human ZFAND1 Recombinant Protein (RPPB5178)
