Human DPPA5 Recombinant Protein (RPPB3373)
제품 코드를 사용하여 Assay Genie 메인 사이트를 통해 주문합니다.
주문- SKU:
- RPPB3373
- Product type:
- Recombinant Protein
- Size:
- 10ug
- Species:
- Human
- Target:
- DPPA5
- Synonyms:
- ESG1
- Synonyms:
- Developmental pluripotency-associated 5 proteins
- Synonyms:
- hDPPA5
- Synonyms:
- Embryonal stem cell-specific gene 1 protein
- Source:
- Escherichia Coli
- Uniprot:
- A6NC42
Frequently bought together:
Description
Product Name: | Human DPPA5 Recombinant Protein |
Product Code: | RPPB3373 |
Size: | 10µg |
Species: | Human |
Target: | DPPA5 |
Synonyms: | ESG1, Developmental pluripotency-associated 5 proteins, hDPPA5,Embryonal stem cell-specific gene 1 protein, ESG-1. |
Source: | Escherichia Coli |
Physical Appearance: | Sterile Filtered clear solution. |
Formulation: | DPPA5 protein solution (0.25mg/ml) containing 20mMPhosphate buffer (pH 8.0), and 10% glycerol. |
Stability: | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles. |
Purity: | Greater than 85.0% as determined by SDS-PAGE. |
Amino Acid Sequence: | MGSSHHHHHH SSGLVPRGSH MGSMGTLPAR RHIPPWVKVP EDLKDPEVFQ VQTRLLKAIFGPDGSRIPYIEQVSKAMLEL KALESSDLTE VVVYGSYLYK LRTKWMLQSM AEWHRQRQER GMLKLAEAMNALELGPWMK |
Developmental pluripotency-associated 5 proteins (DPPA5) is a 116 amino acid protein, which localizes to the cytoplasm and contains one KH domain. DPPA5 is expressed in embryonic germ (EG), primordial germ (PG) and embryonic stem (ES) cells. DPPA5 has an imperative role in the maintenance of ES cell pluripotency and may be essential for proper embryogenesis.
DPPA5 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 139 amino acids (1-116 a.a) and having a molecular mass of 15.9kDa.DPPA5 is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
UniProt Protein Function: | DPPA5: Involved in the maintenance of embryonic stem (ES) cell pluripotency. Dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. Associates with specific target mRNAs. Belongs to the KHDC1 family. |
UniProt Protein Details: | Chromosomal Location of Human Ortholog: 6q13 |
NCBI Summary: | This gene encodes a protein that may function in the control of cell pluripotency and early embryogenesis. Expression of this gene is a specific marker for pluripotent stem cells. Pseudogenes of this gene are located on the short arm of chromosome 10 and the long arm of chromosomes 14 and 19. [provided by RefSeq, Dec 2010] |
UniProt Code: | A6NC42 |
NCBI GenInfo Identifier: | 162416119 |
NCBI Gene ID: | 340168 |
NCBI Accession: | A6NC42.1 |
UniProt Secondary Accession: | A6NC42,B2RPQ7, |
UniProt Related Accession: | A6NC42 |
Molecular Weight: | 13,498 Da |
NCBI Full Name: | Developmental pluripotency-associated 5 protein |
NCBI Synonym Full Names: | developmental pluripotency associated 5 |
NCBI Official Symbol: | DPPA5 |
NCBI Official Synonym Symbols: | ESG1 |
NCBI Protein Information: | developmental pluripotency-associated 5 protein |
UniProt Protein Name: | Developmental pluripotency-associated 5 protein |
UniProt Synonym Protein Names: | Embryonal stem cell-specific gene 1 protein; ESG-1 |
Protein Family: | Developmental pluripotency-associated 5 protein |
UniProt Gene Name: | DPPA5 |
UniProt Entry Name: | DPPA5_HUMAN |