Human BNP Recombinant Protein (RPPB0113)
- SKU:
- RPPB0113
- Product type:
- Recombinant Protein
- Size:
- 10ug
- Species:
- Human
- Target:
- BNP
- Synonyms:
- NPPB
- Natriuretic Peptide Precursor B
- BNP
- B-type Natriuretic Peptide
- Source:
- Escherichia Coli
- Uniprot:
- P16860
Description
| Product Name: | Human BNP Recombinant Protein |
| Product Code: | RPPB0113 |
| Size: | 10µg |
| Species: | Human |
| Target: | BNP |
| Synonyms: | NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide. |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation: | Natriuretic Peptide Precursor B was lyophilized from 0.4ml PBS buffer containing 20mM phosphate buffer and 0.6mM sodium chloride. |
| Solubility: | It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18M?-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Stability: | Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution NPPB should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Purity: | Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Amino Acid Sequence: | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.
B-type Natriuretic Peptide Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. NPPB is purified by proprietary chromatographic techniques.
| UniProt Protein Function: | NPPB: Cardiac hormone which may function as a paracrine antifibrotic factor in the heart. Also plays a key role in cardiovascular homeostasis through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3. Belongs to the natriuretic peptide family. |
| UniProt Protein Details: | Protein type:Secreted; Secreted, signal peptide; Hormone Chromosomal Location of Human Ortholog: 1p36.2 Cellular Component: extracellular region; extracellular space; protein complex Molecular Function:diuretic hormone activity; hormone activity; protein binding; receptor binding Biological Process: body fluid secretion; cell surface receptor linked signal transduction; cGMP biosynthetic process; negative regulation of angiogenesis; negative regulation of cell growth; receptor guanylyl cyclase signaling pathway; regulation of blood pressure; regulation of vascular permeability; regulation of vasodilation |
| NCBI Summary: | This gene is a member of the natriuretic peptide family and encodes a secreted protein which functions as a cardiac hormone. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein's biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. A high concentration of this protein in the bloodstream is indicative of heart failure. The protein also acts as an antimicrobial peptide with antibacterial and antifungal activity. Mutations in this gene have been associated with postmenopausal osteoporosis. [provided by RefSeq, Nov 2014] |
| UniProt Code: | P16860 |
| NCBI GenInfo Identifier: | 113836 |
| NCBI Gene ID: | 4879 |
| NCBI Accession: | P16860.1 |
| UniProt Secondary Accession: | P16860,Q6FGY0, Q9P2Q7, B0ZBE9, |
| UniProt Related Accession: | P16860 |
| Molecular Weight: | 14,726 Da |
| NCBI Full Name: | Natriuretic peptides B |
| NCBI Synonym Full Names: | natriuretic peptide B |
| NCBI Official Symbol: | NPPB |
| NCBI Official Synonym Symbols: | BNP |
| NCBI Protein Information: | natriuretic peptides B |
| UniProt Protein Name: | Natriuretic peptides B |
| UniProt Synonym Protein Names: | Gamma-brain natriuretic peptide |
| Protein Family: | Brain natriuretic peptide |
| UniProt Gene Name: | NPPB |
| UniProt Entry Name: | ANFB_HUMAN |
Related Products
