Human AIF1 Recombinant Protein (RPPB0027)
- SKU:
- RPPB0027
- Product type:
- Recombinant Protein
- Size:
- 10ug
- Species:
- Human
- Target:
- AIF1
- Synonyms:
- AIF-1
- Allograft inflammatory factor 1
- Em:AF12975617
- G1
- Source:
- Escherichia Coli
- Uniprot:
- P55008
Description
| Product Name: | Human AIF1 Recombinant Protein |
| Product Code: | RPPB0027 |
| Size: | 10µg |
| Species: | Human |
| Target: | AIF1 |
| Synonyms: | AIF-1, Allograft inflammatory factor 1, Em:AF129756.17, G1, IBA1, Ionized calcium-binding adapter molecule 1, IRT-1, Protein G1, AIF1. |
| Source: | Escherichia Coli |
| Physical Appearance: | Filtered White lyophilized (freeze-dried) powder. |
| Formulation: | Filtered and lyophilized from 0.5mg/ml in 20mM Tris buffer and 50mM NaCl pH-7.5. |
| Solubility: | Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. |
| Stability: | For long term, store lyophilized AIF1 at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.The lyophilized protein remains stable for 24 months when stored at -20°C. |
| Purity: | Greater than 90% as determined by SDS PAGE. |
| Amino Acid Sequence: | MKHHHHHHASQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP |
Human AIF1 protein shares 98% homology/identity with that of rat. AIF1 is expressed in macrophages and neutrophils. The expression of AIF1 transcripts is upregulated by IFN-g in rat macrophages. AIF1 is expressed selectively in human macrophage-like cell lines, and in a subset of CD68(+) macrophages in the interstitial and perivascular spaces of human heart allografts. In quiescent cultured human vascular smooth muscle cells synthesis of AIF1 is induced by IFN-g, IL1b, and conditioned medium of T-cells. Overexpression of AIF1 in human VSMCs results in enhanced growth of these cells. AIF1 is expressed during apoptosis rat mammary gland and ventral prostate tissues. Allograft Inflammatory Factor 1 is expressed by several tumor-associated activated macrophages and microglial cells in rat and human gliomas. There is an evident relationship of AIF1-expressing activated macrophages and microglial cells with tumor malignancy in humans.
The AIF1 Human Recombinant contains a total of 155 amino acids having a molecular Mass of 17.7kDa. The Human AIF1 is fused to a 9 amino acid long N-terminal His tag.
| UniProt Protein Function: | AIF1: Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T- lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation. 3 isoforms of the human protein are produced by alternative splicing. |
| UniProt Protein Details: | Protein type:Cytoskeletal Chromosomal Location of Human Ortholog: 6p21.3 Cellular Component: perinuclear region of cytoplasm; lamellipodium; cytoplasm; actin filament; perikaryon; nucleus; cytosol; phagocytic cup Molecular Function:actin filament binding; calcium ion binding Biological Process: actin filament bundle formation; positive regulation of nitric oxide biosynthetic process; negative regulation of smooth muscle cell proliferation; positive regulation of smooth muscle cell proliferation; microglial cell activation; Rac protein signal transduction; cellular response to hormone stimulus; actin filament polymerization; positive regulation of muscle hyperplasia; cellular response to extracellular stimulus; positive regulation of T cell proliferation; response to axon injury; positive regulation of protein amino acid phosphorylation; phagocytosis, engulfment; response to electrical stimulus; inflammatory response; negative regulation of apoptosis |
| NCBI Summary: | This gene encodes a protein that binds actin and calcium. This gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain. [provided by RefSeq, Jan 2016] |
| UniProt Code: | P55008 |
| NCBI GenInfo Identifier: | 1703217 |
| NCBI Gene ID: | 199 |
| NCBI Accession: | P55008.1 |
| UniProt Related Accession: | P55008 |
| Molecular Weight: | |
| NCBI Full Name: | Allograft inflammatory factor 1 |
| NCBI Synonym Full Names: | allograft inflammatory factor 1 |
| NCBI Official Symbol: | AIF1 |
| NCBI Official Synonym Symbols: | IBA1; IRT1; AIF-1; IRT-1 |
| NCBI Protein Information: | allograft inflammatory factor 1 |
| UniProt Protein Name: | Allograft inflammatory factor 1 |
| UniProt Synonym Protein Names: | Ionized calcium-binding adapter molecule 1; Protein G1 |
| Protein Family: | Putative apoptosis-inducing factor |
| UniProt Gene Name: | AIF1 |
| UniProt Entry Name: | AIF1_HUMAN |
Related Products
