Human AHSG Recombinant Protein (RPPB2719)
- SKU:
- RPPB2719
- Product type:
- Recombinant Protein
- Size:
- 10ug
- Species:
- Human
- Target:
- AHSG
- Synonyms:
- Alpha-2-HS-glycoprotein
- Fetuin-A
- Alpha-2-Z-globulin
- Ba-alpha-2-glycoprotein
- Source:
- HEK293 Cells
- Uniprot:
- P02765
Description
| Product Name: | Human AHSG Recombinant Protein |
| Product Code: | RPPB2719 |
| Size: | 10µg |
| Species: | Human |
| Target: | AHSG |
| Synonyms: | Alpha-2-HS-glycoprotein, Fetuin-A, Alpha-2-Z-globulin, Ba-alpha-2-glycoprotein, AHSG, FETUA, AHS, A2HS, HSGA, PRO2743. |
| Source: | HEK293 Cells |
| Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation: | AHSG was lyophilized from a 0.2 µM filtered solution of 20mM PB and 150mM NaCl, pH 7.5. |
| Solubility: | It is recommended to reconstitute the lyophilized AHSG in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions. |
| Stability: | Lyophilized AHSG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution AHSG should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles. |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Amino Acid Sequence: | APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKVVDHHHHHH |
Fetuin is a liver-produced negative acute phase protein composed of two subunits, the A and B chains.Fetuin homologs have been identified in several species including rat, sheep, pig, rabbit, guinea pig, cattle, mouse and human. Multiple physiological roles for these homologs have been suggested, including ability to bind to hydroxyapatite crystals and to specifically inhibit the tyrosine kinase (TK) activity of the receptor (IR).Fetuin-A (alpha2-Heremans-Schmid glycoprotein; AHSG) is an important circulating inhibitor of calcification in vivo, and is downregulated during the acute-phase response.Sera from patients on long-term dialysis with low AHSG concentrations showed impaired ex-vivo capacity to inhibit CaxPO4 precipitation.Fetuin may influence the resolution of inflammation by modulating the phagocytosis of apoptotic cells by macrophages.ASHG blocks TGF-beta-dependent signaling in osteoblastic cells, and mice lacking ASHG display growth plate defects, increased bone formation with age, and enhanced cytokine-dependent osteogenesis.
AHSG Human Recombinant produced by transfected human cells is a single polypeptide chain containing 357 amino acids (19-367). AHSG is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques.
| UniProt Protein Function: | FETUA: Promotes endocytosis, possesses opsonic properties and influences the mineral phase of bone. Shows affinity for calcium and barium ions. Alpha-2-HS glycoprotein derives from this precursor, when the connecting peptide is cleaved off. The two chains A and B are held together by a single disulfide bond. Synthesized in liver and selectively concentrated in bone matrix. Secreted in plasma. It is also found in dentin in much higher quantities than other plasma proteins. Belongs to the fetuin family. |
| UniProt Protein Details: | Protein type:Secreted; Secreted, signal peptide Chromosomal Location of Human Ortholog: 3q27 Cellular Component: extracellular space; extracellular region Molecular Function:kinase inhibitor activity; cysteine protease inhibitor activity Biological Process: negative regulation of bone mineralization; pinocytosis; ossification; positive regulation of phagocytosis; regulation of inflammatory response; acute-phase response; negative regulation of phosphorylation; negative regulation of insulin receptor signaling pathway; skeletal development; regulation of bone mineralization |
| NCBI Summary: | Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure. [provided by RefSeq, Jul 2008] |
| UniProt Code: | P02765 |
| NCBI GenInfo Identifier: | 112910 |
| NCBI Gene ID: | 197 |
| NCBI Accession: | P02765.1 |
| UniProt Secondary Accession: | P02765,O14961, O14962, Q9P152, A8K9N6, B2R7G1, |
| UniProt Related Accession: | P02765,AAB29984 |
| Molecular Weight: | 39,325 Da |
| NCBI Full Name: | Alpha-2-HS-glycoprotein |
| NCBI Synonym Full Names: | alpha-2-HS-glycoprotein |
| NCBI Official Symbol: | AHSG |
| NCBI Official Synonym Symbols: | AHS; A2HS; HSGA; FETUA |
| NCBI Protein Information: | alpha-2-HS-glycoprotein; fetuin-A; alpha-2-Z-globulin; ba-alpha-2-glycoprotein |
| UniProt Protein Name: | Alpha-2-HS-glycoprotein |
| UniProt Synonym Protein Names: | Alpha-2-Z-globulin; Ba-alpha-2-glycoprotein; Fetuin-ACleaved into the following 2 chains:Alpha-2-HS-glycoprotein chain A; Alpha-2-HS-glycoprotein chain B |
| Protein Family: | Alpha-2-HS-glycoprotein |
| UniProt Gene Name: | AHSG |
| UniProt Entry Name: | FETUA_HUMAN |
Related Products
