HPV 11 Recombinant Protein (RPPB5614)
- SKU:
- RPPB5614
- Product type:
- Recombinant Protein
- Size:
- 0.5mg
- Species:
- HPV
- Target:
- 11
- Synonyms:
- Papillomavirus
- HPV
- Papilloma Virus
- Source:
- Escherichia Coli
Description
| Product Name: | HPV 11 Recombinant Protein |
| Product Code: | RPPB5614 |
| Size: | 0.5mg |
| Species: | HPV |
| Target: | 11 |
| Synonyms: | Papillomavirus, HPV, Papilloma Virus. |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile filtered clear liquid formulation. |
| Formulation: | Recombinant HPV11 solution in PBS, 3M Urea and 100mM arginine. |
| Stability: | Recombinant HPV-11 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles. |
| Purity: | Protein is >80% pure as determined by 10% PAGE (coomassie staining). |
| Amino Acid Sequence: | VDKLWRPSDSTVYVPPPNPVSKVVATDAYVKRTNIFYHASSSRLLAVGHPYYSIKKVNKTVVPKVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPLLNKYDDVENSGGYGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGTQCSNTSVQNGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPLDICGTVCKYPDYLQMAADPYGDRLFFYLRKEQMFARHFFNRAGTVGEPVPDDLLVKGGNNRSSVASSIYVHTPSGSLVSSEAQLFNKPYWLQKAQGHNNGICWGNHLFVTVVDTTRSTNMTLCASVSKSATYTNSDYKEYMRHVEEFDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQAITCQKPTPEKEKQDPYKDMSFWEVNLKEKFSSELDQFPLGRKFLLQSGYRGRTSARTGIKRPAVSKPSTAPKRKRTKTKKKFGTKLSR |
Human papillomaviruses (HPVs) are a group family with more than 150 related viruses. HP 6 and 11 considered as low-risk HPVs can be sexually transmitted, causing warts to emerge on or around the genitals or anus, known as condylomata acuminate. HPV 11 major/large capsid antigen is used in clinical diagnosis to test the specific antibody to this virus induced by the virus infection, the positive reaction of this antibody is deemed as a marker for present and past infection. Furthermore, HPV 11 large capsid is used as a potential candiadate for vaccine development.
Recombinant HPV-11 antigen is a 58.1kDa protein covering the full length of HPV-11 major capsid, its N-terminus is fused with a GST tag, having a total molecular weight of 84kDa. The HPV-11 was purified by proprietary chromatographic technique.
Related Products
