HIV-1 Integrase Recombinant Protein (RPPB5585)
- SKU:
- RPPB5585
- Product type:
- Recombinant Protein
- Size:
- 0.5mg
- Species:
- HIV-1
- Target:
- Integrase
- Source:
- Escherichia Coli
Description
| Product Name: | HIV-1 Integrase Recombinant Protein |
| Product Code: | RPPB5585 |
| Size: | 0.5mg |
| Species: | HIV-1 |
| Target: | Integrase |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile filtered colorless clear solution. |
| Formulation: | 1.5M urea, 25mM Tris-HCl pH 8.0, 0.2% Triton-X & 50% Glycerol. |
| Stability: | HIV-1 Integrase although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles. |
| Purity: | Greater than 95.0% as determined by SDS-PAGE. |
| Amino Acid Sequence: | MFLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDEDHHHHHH |
Integrase is an enzyme produced by the HIV which enables its genetic material to be integrated into the DNA of the infected cell and is a key component in the pre-integration complex. HIV integrase contains 3 domains, an N-terminal HH-CC zinc fingerdomainwhich is partially responsible for multimerization, a central catalytic domain and a C-terminal domain. Both Central catalytic domain and C-terminal domains have been shown to bind both viral and cellular DNA. No crystal structure data exists with Integrase bound to its DNA substrates. HIV-1 integrase functions as a dimeror a tetramer. Additionally, several host cellular proteins interact with integrase and may facilitate the integration process.
The E.coli derived 36 kDa recombinant protein is a non-glycosylated polypeptide chain, containing the HIV-1 immunodominant regions from the pol protein (intergrase) and fused with a six histidines tag.
Related Products
