Ag85B Recombinant Protein (RPPB2711)
- SKU:
- RPPB2711
- Product type:
- Recombinant Protein
- Size:
- 10ug
- Target:
- Ag85B
- Synonyms:
- Antigen 85-B
- 85B
- Extracellular alpha-antigen
- Antigen 85 complex B
- Source:
- Escherichia Coli
- Uniprot:
- P0C5B9
Frequently bought together:
Description
| Product Name: | Ag85B Recombinant Protein |
| Product Code: | RPPB2711 |
| Size: | 10µg |
| Target: | Ag85B |
| Synonyms: | Antigen 85-B, 85B, Extracellular alpha-antigen, Antigen 85 complex B, Ag85B, Mycolyl transferase 85B, EC 2.3.1.-, Fibronectin-binding protein B, 30 kDa extracellular protein, fbpB, A85B, Major Secretory Protein Antigen 85B. |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile Filtered and lyophilized, though might appear as a solution as a result of the glycerol content. |
| Formulation: | Lyophilized with 0.1% glycerol. |
| Solubility: | It is recommended to reconstitute the lyophilized Antigen-85B in sterile 18M?-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Stability: | Ag85B although stable room temperature for 4 weeks, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Purity: | Greater than 90.0% as determined by SDS-PAGE. |
| Amino Acid Sequence: | MRGSHHHHHHFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG |
| UniProt Code: | P0C5B9 |
Antigen 85B Mycobacterium Tuberculosis-is the most abundant protein exposed by M. Tuberculosis, as well as a potent immunoprotective antigen and a leading drug target. Ag85 induces strong T-cell proliferation and IFN-g secretion in most healthy individuals exposed to M. tuberculosis, in BCG-vaccinated mice and humans, whereas the antibody against Ag85 are more prevalent in active tuberculosis patients with decreased cellular immune response.
Ag85B Recombinant His-Tag fusion protein produced in E.Coli is a single, non-glycosylated polypeptide chain having a molecular mass of 30kDa.
Related Products
