Pramlintide Recombinant Protein (RPPB1352)
제품 코드를 사용하여 Assay Genie 메인 사이트를 통해 주문합니다.
주문- SKU:
- RPPB1352
- Product type:
- Recombinant Protein
- Size:
- 5mg
- Target:
- Pramlintide
- Source:
- Synthetic
Frequently bought together:
Description
Product Name: | Pramlintide Recombinant Protein |
Product Code: | RPPB1352 |
Size: | 5mg |
Target: | Pramlintide |
Source: | Synthetic |
Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
Formulation: | The protein was lyophilized with no additives. |
Solubility: | It is recommended to reconstitute the lyophilized Pramlintide in sterile 18M?-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. The Pramlintide is also soluble in 1% Acetic Acid. |
Stability: | Lyophilized Pramlintide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Pramlintide should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
Purity: | Greater than 98.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Amino Acid Sequence: | KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 |
Pramlintide acetate is a hormone that is released into the bloodstream, in a similar pattern as insulin. Pramlintide aids in the absorption of glucose by slowing gastric emptying, promoting satiety, and inhibiting inappropriate secretion of glucagon, a catabolic hormone that opposes the effects of insulin.
Pramlintide Synthetic is a single, non-glycosylated polypeptide chain containing 37 amino acids, having a molecular mass of 3949.4 Dalton and a Molecular formula of C171H267N51O53S2.