Human IL37 Recombinant Protein (RPPB0688)
제품 코드를 사용하여 Assay Genie 메인 사이트를 통해 주문합니다.
주문- SKU:
- RPPB0688
- Product type:
- Recombinant Protein
- Size:
- 25ug
- Species:
- Human
- Target:
- IL37
- Synonyms:
- Interleukin-37
- Synonyms:
- FIL1 zeta
- Synonyms:
- IL-1X
- Synonyms:
- Interleukin-1 family member 7
- Source:
- Escherichia Coli
- Uniprot:
- Q9NZH6
Description
Product Name: | Human IL37 Recombinant Protein |
Product Code: | RPPB0688 |
Size: | 25µg |
Species: | Human |
Target: | IL37 |
Synonyms: | Interleukin-37, FIL1 zeta, IL-1X, Interleukin-1 family member 7, IL-1F7, Interleukin-1 homolog 4, IL-1H, IL-1H4, Interleukin-1 zeta, IL-1 zeta, Interleukin-1-related protein, IL-1RP1, Interleukin-23, IL-37, IL37, FIL1Z, IL1F7, IL1H4, IL1RP1, FIL1, FIL1(ZETA). |
Source: | Escherichia Coli |
Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
Formulation: | IL37 was lyophilized from a 0.2?M filtered solution of 20mM PB, 150mM NaCl and 2mM DTT pH 7.4. |
Solubility: | It is recommended to quick spin followed by reconstitution of IL37 in PBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions. |
Stability: | Lyophilized IL37 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-37 should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles. |
Purity: | Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Amino Acid Sequence: | MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD |
Biological Activity: | As measured by its binding ability in a functional ELISA, immobilized IL1F7 at 1 µg/ml (100 µl/well) can bind rhIL-18 R/Fc Chimera with a linear range of 0.015-1µg/ml. |
Human interleukin family 1, member 7 (IL1F7) belongs to the interleukin 1 cytokine family. There are 5 alternatively spliced transcript variants encoding distinct isoforms with distinct expression profiles. The longest IL-1F7 transcript, named IL1F7b or IL1F7 isoform 1, encodes a 218 aa residues proprotein and containing a 45 aa propeptide which is cleaved to produce a mature protein. IL1F7b binds to IL18 Rb with low affinity however it doesn’t exert any IL18 agonistic or antagonistic effects. IL1F7b also binds IL18BP (interleukin 18 binding protein), which is an inhibitory binding protein of interleukin 18 (IL18), and afterward forms a complex with IL18 receptor beta subunit, and through which it inhibits the activity of IL18.
Interleukin-37 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 167 amino acids (Lys27-Asp192) and having a molecular mass of 18.6kDa.The IL37 is purified by proprietary chromatographic techniques.
UniProt Protein Function: | IL37: Suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. This function requires SMAD3. Suppresses, or reduces, proinflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation. Belongs to the IL-1 family. 5 isoforms of the human protein are produced by alternative splicing. |
UniProt Protein Details: | Protein type:Cytokine Chromosomal Location of Human Ortholog: 2q12-q14.1 Cellular Component: cytoplasm; cytosol; extracellular region; extracellular space; nucleolus; nucleus Molecular Function:cytokine activity; interleukin-1 receptor binding Biological Process: cytokine and chemokine mediated signaling pathway; immune response; inflammatory response to antigenic stimulus |
NCBI Summary: | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine can bind to, and may be a ligand for interleukin 18 receptor (IL18R1/IL-1Rrp). This cytokine also binds to interleukin 18 binding protein (IL18BP), an inhibitory binding protein of interleukin 18 (IL18), and subsequently forms a complex with IL18 receptor beta subunit, and through which it inhibits the activity of IL18. This gene along with eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Five alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
UniProt Code: | Q9NZH6 |
NCBI GenInfo Identifier: | 25008593 |
NCBI Gene ID: | 27178 |
NCBI Accession: | Q9NZH6.1 |
UniProt Secondary Accession: | Q9NZH6,Q56AP9, Q8TD04, Q8TD05, Q9HBF2, Q9HBF3, Q9UHA6 B5BU97, |
UniProt Related Accession: | Q9NZH6 |
Molecular Weight: | 17,459 Da |
NCBI Full Name: | Interleukin-37 |
NCBI Synonym Full Names: | interleukin 37 |
NCBI Official Symbol: | IL37 |
NCBI Official Synonym Symbols: | FIL1; FIL1Z; IL-1H; IL-37; IL1F7; IL1H4; IL-1F7; IL-1H4; IL1RP1; IL-1RP1; FIL1(ZETA) |
NCBI Protein Information: | interleukin-37 |
UniProt Protein Name: | Interleukin-37 |
UniProt Synonym Protein Names: | FIL1 zeta; IL-1X; Interleukin-1 family member 7; IL-1F7; Interleukin-1 homolog 4; IL-1H; IL-1H4; Interleukin-1 zeta; IL-1 zeta; Interleukin-1-related protein; IL-1RP1; Interleukin-23; IL-37 |
Protein Family: | Interleukin |
UniProt Gene Name: | IL37 |
UniProt Entry Name: | IL37_HUMAN |